McDonnell Genome Institute

Washington University

CircRNA

chr7|152138795|152159072|-|KMT2C|ENST00000262189.10

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9982

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

LCTLALTR

Amino Acids from 5' Exons

VYQPFVCTLCGSGDFERTQNYHQLQSENPERRR,YINHSCAPNCVAEVVTFERGHKIIISSSRRIQKGEE,ISTIRVHLIVWLKWLLREDTKLSSAPVGESRKEK

Amino Acids from 3' Exons

QTLGAQMQGGFGCGNQLPKTDGGSETKKQRSKRTQRTGEKAAPRSKKRKKDEEEKQAMYSSTDTFTHLKQ,KLWGLKCKVVLDVATSCQKQMEEVKPRNSEANGLRGRVRKQHLAQRKGKRTKRRNKLCTLALTRLPTN,NFGGSNARWFWMWQPVAKNRWRKNQETAKQTDSEDGESSTSLKEKEKGRRGETSYVLHHVYPLET