McDonnell Genome Institute

Washington University

CircRNA

chr7|151128579|151134568|+|AGAP3|ENST00000397238.6

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9896

20

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

9

Peptide

SNTQLGGGTGDPAK

Amino Acids from 5' Exons

GILLKRSGKSLNKEWKKKYVTLCDNGLLTYHPSLH,GSCSGAASPTRSGRRSMRSVTTGCSPITPAC,DPAKAERQVPEQGVEEEVCDALQRAAHLSPQPA

Amino Acids from 3' Exons

DYMQNIHGKEIDLLRTTVKVPGKRLPRATPATAPGTSPRANGLSVERSNTQLGGGT,ITCRTSTARRLTCCGQRKCQGSACPEPHLPQPRAPAPVPTGCPWSGVTHSWVGAQ,LHAEHPRQGDPAADNGESAREAPAPSHTCHSPGHQPPCQRAVRGAEHTAGWGH