McDonnell Genome Institute

Washington University

CircRNA

chr7|149011845|149012360|-|PDIA4|ENST00000286091.8

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9841

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

14

12

Peptide

GESDPAYQQYQDAGVDTARNLPPSMR

Amino Acids from 5' Exons

ESLITSSSPGLPPRRFPSRSRSSRMETMSSSSGSLRGRVTQPTSNTRMP,NRLHDRAVRASLQGDSDPEAGPGVPEGWRRCHHHRGLGGEPSLPAIPGC,IVDYMIEQSGPPSKEILTLKQVQEFLKDGDDVIIIGVFKGESDPAYQQYQDA

Amino Acids from 3' Exons

VWTLQETCPRVEGRQGAQQAFSSNSPGKGRRHRRNRPGQEVCLWLSHPENFPQRKALLQRPTRKI,CGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATAETDLAKRFDVSGYPTLKIFRKGRPYDYNGPREKY,VDTARNLPPSMRRPPRSSASVLLQFPWQRSTPPQKQTWPRGLMSLAIPPKFSAKEGLMTTTAHEKNM