McDonnell Genome Institute

Washington University

CircRNA

chr7|143267616|143268943|+|GSTK1|ENST00000442394.5

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9716

23

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

11

Peptide

ALGLGFLYLIEAAEK

Amino Acids from 5' Exons

AAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYG,LQRRLVCLQNKPRDFWKRSQRQRRTSSRRPLRQPADT,CREGWYVCRTSPGTSGKDRNAKGEEPAQGDHGSLQIR

Amino Acids from 3' Exons

ERSGWALYLQPMPDFKIARRKQTLRIKKAGHLLNPWLHHKALGLGFLYLIE,REVDGPYTSSRECQTLRLPGGSKLFVKKQAICLTLGSTIRHWDSDFSI,EKWMGPIPPAVNARLDCPEEANSSYKKSRPSAPLAPPGTGTRISLSDR