McDonnell Genome Institute

Washington University

CircRNA

chr7|143264085|143265092|+|GSTK1|ENST00000473649.1

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9743

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

12

Peptide

EELVLHQESSKR

Amino Acids from 5' Exons

ILCRYQNIWNINLQLRPSLITGIMKDS,SCAGIRISGTSTCSCGPASQGSKTV,PVPVSEYLEHQPAVAAQPHNRDHERQ

Amino Acids from 3' Exons

ETSLQVCFPAKDYTWQMTSSDTISRFPSTSPRISCLCLKKVKRVGCRQGIQKTQKSEIEGLIGWRGCGRLKQVKPALGNLRISLERAEGCRAKGRRAGKVMGTLGERLRAEELWGMSEARKSSSTRKAARGALPLGASAPQEVCLPCVSSPPTWSIQRCWRKRPGSCGCASGQ,KQASRSASPQRTIHGKLKAPETPSPDSHPLPQGFLVCDAKRREWDVDRVSSEKHRSRRLRDDGGAAGDSKSLPWETSGSALSELKVAGHEREEEQANRSWEPWVRGGRRSSGGCQKQGRASPPPGKQQEEPCLWVPLPHRKFVCHAFPHRRELGASRDAGESVPGAVDARLVK,NKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGEESGMTGYPVKNTEVGDGIDRMEGLRETKASEACLGKPQDQPASRLPGMKGKKSRQIGHGNLGEAEGGGALGDVRSKEELVLHQESSKRSPASGCLCPTGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSR