McDonnell Genome Institute

Washington University

CircRNA

chr7|140573807|140587780|-|DENND2A|ENST00000275884.10

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9584

13

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

MELGPLPK

Amino Acids from 5' Exons

QSLSKPAFFRQNSERRNFKLLDTRKLSRDGTGSPSKISPPSTPSSPDDIFFNLGDPQNGRKKRKIPK,SHCPNLLFSDKIQRGGTSSCWTLGSVGMELGPLPKSALPPLPAALMTFSLTLETHRTAGRRERYP,VIVQTCFFPTKFREEELQAAGHEAESGWNWVPFQNQPSLHSQQPHFLPWRPTERQEEEKDTQ

Amino Acids from 3' Exons

KVLVRFTAVFLEQQGGLVRADAGADTHFIGGERLRHS,KSYEFEDLLQSSSESSRVDWYAQTKLGLTRTLSEENVYEDIL,SPMSLKIYCSLPLRAAGWTGTRRLSWGHALYRRRTSMKTF