McDonnell Genome Institute

Washington University

CircRNA

chr7|139398598|139402247|+|C7orf55-LUC7L2|ENST00000263545.7

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

14

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

15

Peptide

LAETQEEISAEVAAKR

Amino Acids from 5' Exons

RMDLGECLKVHDLALRADYEIASKEQDFFFELD,EWILENVKSMTWLERIMKLHPKNKIFSLNL,NGSWRMSESPPGFKSGLNCIQRTRFFLT

Amino Acids from 3' Exons

AMDHLQSFIADCDRRTEVAKKRLAETQEEISAEVAAK,PWIICSHSLQIVIVEQKWPRKDQKLKKRLVLKQQ,HGSSAVIHCRLSNRSGQEKISRNSRRDCSSSK