McDonnell Genome Institute

Washington University

CircRNA

chr7|138898954|138919438|-|KIAA1549|ENST00000422774.1

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9525

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

19

Peptide

IQGVIAQHELSPEQHNLSLYSMELVLK

Amino Acids from 5' Exons

VVNVSRLEGDDNPVQLIYFVEDQDGERLSAVKSSDLINKMDLQRAAIILGYRIQGVIAQ,WMCRGWREMTIRYSSSTLWRIKMEKDSVQSSLRTLTKWTSREQPSSWVTEFKVSLPS,GKCVEAGGRQSGTAHLLCGGSRWRKTQCSQVFGPDQNGPPESSHHLGLPNSRCHCP

Amino Acids from 3' Exons

MSSLRNSTTFLYTPWSSCRKALGTALHKWPQKLLPAPSTAVLSMSQPRRLPLLLIQPFLTKENRPKVQQIPASLWQLTCQRVKRWPSMTMRWITFCQILTGPLHGWFLQYSISQSAHQGCPGKHNLCSLHHYPWFLYKMKKHRAGRTQRDNQRHMLSPPVISTPFGQLFAPLRASFQLLAGIWCFILLMLTVIYQAGLCQRLWLPQRVWKPPFFAPGLCHSRATALLYRCPPWGRSHSLQRRFGPQVQTDTLMPLCVKAKKPSLQEHTPLLHRTQPLHSAGHILHCFQLLLHLRPLLHQLMFHLTPFSLATPAKHPNCIAIQPSPVLWTTLISARCPHSDHTLGVRPALCLHLSKFWPRASWRKTWDQGMVPRLCAPCWKKAASLVASQTSLNLRKILKYLIRFSPPDLSSHFLLDPWKSQRRVLAFLPRWIVVLQPHRFPLPTAASLCRRHLILLLAPCLLLKPKRHPAPLHFSRSSPAFSLTHLSLSQTKTHRRLPSETRVFLRLIVWFLQWSLHFSLTKNVPVFLSINPEVLWILHPAFSQHPRWNSAAPSLRLRKHLRLCLCRVTCPPSHLSLFLPWLRHLHCLTLVICSHLSCLFPVPQILSFRSSSQVPSCLTPSCCYLAVLRCHHGQASLLILSSLLKRLRFHRIQKLILPQLSLKLPPILSLHSFPMNPQSLHWCPPALSLLTFLPGFKQHHHPLSTQRPFLSLLCSQLHLLTTKSVLTVTCLSWPLSPKPFPLVRCSLTRTCHQDPRLFLKQPPSLCPQSPSWAHHSHPQRCHTPPRKAQPAPVLPLVVPSTPPWVTPQVRAPQRVVLLLPCHPCVPLPSLSKQQSTHQHWLLPSRHMFVISQSPMPISQL,ALSGTAQPFFILHGARAEEKHWAQRCTSGLNRNCSRLPAQQSSPCHSPAVCHYFYSLFPRKTDQKYSRSQHLCGNLRVSDERGGRQRDGLSARYSLDHSTDGFSNTVYHSQPTRAAQGSIRTYAHSIITHGFFTRRSDIGLAEHNATTSGICVRQSFPHLSVSFSHLGHRSNSWQEFGALSYCLQSFIKQDSARDCGFPNRGCGNHPFFKLPVFNATAVRRRHYYTVALLGGGLTASRGGLGHKCRQIHCDHCVESKPRRNHLSKNIPHCDCIARSPCIQQDTFSIAFNSSCICVLCFTNCFIPLSPRLQQNIRIAQFSPPRSCGQHSYPEPGVLIQTIHLVCGLHCAFTSASSGHEPHGERRGIRGWCRDSVHDRAGRKQHLSNERRSRLLIGRSSSIYAFPLQTYRPTFFIHGNLRDECWHFCRGGYECYNHTGSPCPRPPLCAGVTSYCWLLVCCNPSDAIQRDHCIFLGHHQHSPLIFLCHSKQKHTVACRQRPECFYALSGSFSGVFTFLPRTFQFFATQRCFGFCIQLFLNTPAGTQRLHLFAFGSTCVSVSDAELVPLHISVFFSLGDIYIVLSAVISAVSSQFHKSVFAAPAKFRAAFKHHHVATPFGVTMVKLPFFSRVCSVYGFTDGFRSSFYLSFHNYLLSVFTHFPIRSHCTGAPRLVFHFDCRDSSNITIDHCPHNAHFNVFFVLNSDTSRPNQCSRRSRVCPGLFLQSHSHWYGVDHRVPAIRILVCFSNPLPSAHRADRRGPITHTHRGATEHLHGSEHNQHRCCHWWSPRLHPDGRRKSEPPRECCSSPAIPASRDCLHSRSNSRHTNTGYCQAAICLYHSPRCLSDHN,ELSPEQHNLSLYSMELVLKKSTGHSAAQVALTETAPGSQHSSPLHVTAPPSATTFDTAFFNQGKQTKSTADPSIFVATYVSVTSKEVAVNDDEMDNFLPDTHWTTPRMVSPIQYITVSPPGLPREALEPMLTPSLPMVSLQDEEVTSGWQNTTRQPAAYAESASHFHTFRSAFRTSEGIVPTPGRNLVLYPTDAYSHLSSRTLPEIVASLTEGVETTLFLSSRSLMPQPLGDGITIPLPSLGEVSQPPEEVWATSADRYTDVTTVLSQSLEETISPRTYPTVTASHAALAFSRTHSPLLSTPLAFASSASPTDVSSNPFLPSDSSKTSELHSNSALPGPVDNTHILSPVSSFRPYTWCAACTVPSPQQVLATSLMEKDVGSGDGAETLCMTVLEESSISLMSSVVADFSEFEEDPQVFNTLFPSRPIVPLSSRSMEISETSVGISAEVDMSSVTTTQVPPAHGRLSVPASLDPTAGSLSVAETQVTPSSVTTAFFSVITSILLDSSFSVIANKNTPSLAVRDPSVFTPYSLVPSVESSLFSDQERSSFSEHKPRGALDFASSFFSTPPLELSGSISSPSEAPASLSLMPSDLSPFTSQSFSPLVETFTLFDSSDLQSSQLSLPSSTNLEFSQLQPSSELPLNTIMLLPSRSEVSPWSSFPSDSLEFVEASTVSLTDSEAHFTSAFIETTSYLESSLISHESAVTALVPPGSESFDILTAGIQATSPLTTVHTTPILTESSLFSTLTPPDDQISALDGHVSVLASFSKAIPTGTVLITDAYLPSGSSFVSEATPFPLPTELTVVGPSLTPTEVPLNTSTEVSTTSTGAATGGPLDSTLMGDAASQSPPESSAAPPLPSLRPVTAFTLEATVDTPTLATAKPPYVCDITVPDAYLITT