McDonnell Genome Institute

Washington University

CircRNA

chr7|138105306|138107580|+|AKR1D1|ENST00000242375.7

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9964

44

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

4

Peptide

ENFQAMEACK

Amino Acids from 5' Exons

AMEACKDAGLVKSLGVSNFNRRQLELILNKPGLKHKPVSNQ,RWKLAKTLAWNPWECPILTAGSWSSSTSQDSNTSQSAT,DGSLQRRWLGEIPGSVQFPQAAGAHPEQARTQTQASQQP

Amino Acids from 3' Exons

GECFFSTFVKGCTSKLIGEKVQDSSSNCFAFQHPARGGCHSKLSKDQRKFS,VNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQ,MFLLHLCRMHFTHWGKGTIRQQLKLFCVSTSSEGWLSFLKALILKGSKKIF