McDonnell Genome Institute

Washington University

CircRNA

chr7|137571174|137690002|-|DGKI|ENST00000288490.9

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9943

25

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

2

Peptide

SLDLPWPLWK

Amino Acids from 5' Exons

ILCWHNALGKPRSPFRTSASWLYSHWIYHGLF,YCAGTMPWGNPGDHHDFEPQRHDDGYIEVIGFTMASL,IVLAQCPGETQVITMISNLSVMMMVILKSLDLPWPL

Amino Acids from 3' Exons

ESNLPGRPPASGSCTSPQPSCGKWSSQGAQSDFGLE,KAISRAGLQHLAPAHPLSLPVANGPAKEPRATLDWS,KQSPGQASSIWLLHIPSAFLWQMVQPRSPERLWTG