McDonnell Genome Institute

Washington University

CircRNA

chr7|135363853|135398226|-|CNOT4|ENST00000451834.5

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9975

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

1

Peptide

EWQDGLR

Amino Acids from 5' Exons

TTAVLRVIRNGRTGGHFYPTLTSTLVDCPILLPPPTPTTVHQRPTLPPPTAVGTALAAGQTQPSSQ,QQQFCREFKYEGMAGRAKGTSTQHHQLWWTAQFFFPLQRQPQCTNVQHCHHRQPELGQPWQLDRPSHHH,NSSSVESLNMKEWQDGLRALLPNININFGGLPNSSSPSNANHSAPTSNTATTDSLSWDSPGSWTDPAIIT

Amino Acids from 3' Exons

PHQTFRFSQYRERFPA,PIDKPSDSLSIGNGDNSQQ,PLTNLQILSVGTVIIPS