McDonnell Genome Institute

Washington University

CircRNA

chr7|134932987|134933390|+|CALD1|ENST00000361901.6

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9954

31

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

MIGGMLK

Amino Acids from 5' Exons

CARGGQDNHHKHSSGRGGRIPGAPGSAGKTPKTPSGGSGAAEGVRPNNNRCKSVAPKQKNAKHSRKNYREGRKKKSPRKIRDRGNRNSHQVLPEELEGCRKQERRQGKGGGGRGEAKAREHWRKS,VPDEEAKTTTTNTQVEGDDEAAFLERLARREERRQKRLQEALERQKEFDPTITDASLSLPSRRMQNDTAENETTEKEEKSESRQERYEIEETETVTKSYQKNDWRDAEENKKEDKEKEEEEEEKPKRGSIGENQ,CLTRRPRQPPQTLKWKGMMRPHSWSAWLGVRKDAKNAFRRLWSGRRSSTQQQMQVCRSQAEECKMTQQKMKLPRRKKKVKVAKKDTRRKQKQSPSPTRRMIGGMLKKTRKKTRKRRRRKRRSQSEGALEKI

Amino Acids from 3' Exons

CARGGQDNHHKHSSGRGGRIPGAPGSAGKTPKTPSGGSGAAEGVRPNNNRCKSVAPKQKNAKHSRKNYREGRKKKSPRKIRDRGNRNSHQVLPEELEGCRKQERRQGKGGGGRGEAKAREHWRKS,VPDEEAKTTTTNTQVEGDDEAAFLERLARREERRQKRLQEALERQKEFDPTITDASLSLPSRRMQNDTAENETTEKEEKSESRQERYEIEETETVTKSYQKNDWRDAEENKKEDKEKEEEEEEKPKRGSIGENQ,CLTRRPRQPPQTLKWKGMMRPHSWSAWLGVRKDAKNAFRRLWSGRRSSTQQQMQVCRSQAEECKMTQQKMKLPRRKKKVKVAKKDTRRKQKQSPSPTRRMIGGMLKKTRKKTRKRRRRKRRSQSEGALEKI