McDonnell Genome Institute

Washington University

CircRNA

chr7|133917582|133938069|+|EXOC4|ENST00000253861.4

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9241

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

3

Peptide

NLSSVHPGQK

Amino Acids from 5' Exons

GYCPVRRKTCHQCILGKRYQQTLEISTKLDEYGSTQTAEAKKRGGRRFHK,GIVQSEEKLVISASWAKDDDISRLLKSLPNWMNMAQPKQLRPKREEEEDFI,VLSSQKKNLSSVHPGQKMMISADSNLYQTGIWLNPNSGQKERRKKIS

Amino Acids from 3' Exons

GSFWQGVSSYWEPGINPSTRHPSRQPQSLGQHAKPGMVGKSNKVSFLQSFYIP,AAFGKESEVLIGNLGDKLIPPQDILRDVSDLKALANMHESLEWLASRTKSAFSNLSTSQ,QLLARSLKFLLGTWVINSLHKTSFVTSVTSKPWPTCMKAWNGWQVEQSQLSPIFLHPR