McDonnell Genome Institute

Washington University

CircRNA

chr7|131437784|131478677|+|MKLN1|ENST00000352689.10

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9014

17

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

8

Peptide

LVQILQLWNGPSAR

Amino Acids from 5' Exons

NGPSARSCHKMCIDIQRRQIYTLGRYLDSSVRNSKSLKSDFYRYDIDTNTWMLLSEDTAADGGPKLVFDHQ,MVLVPDRVIKCALIFNGGKSTHWGVTWIPLGTANLKVTSIVMTLIQTHGCYVRILLLMEGRNWCLII,WSCQIVSNVHYSTEANLHIGALLGFLCEEQQISEKLLSLHYKHMDVTKGYCCWRAEIGVSS

Amino Acids from 3' Exons

FQLLASALFKSGSDFTAL,FSSWHQLYSNLVQILQLW,SAPGISSIQIWFRFYSS