McDonnell Genome Institute

Washington University

CircRNA

chr7|131437784|131445903|+|MKLN1|ENST00000352689.10

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9741

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

4

Peptide

TLGWNGPSARSCHK

Amino Acids from 5' Exons

NGPSARSCHKMCIDIQRRQIYTLGRYLDSSVRNSKSLKSDFYRYDIDTNTWMLLSEDTAADGGPKLVFDHQ,MVLVPDRVIKCALIFNGGKSTHWGVTWIPLGTANLKVTSIVMTLIQTHGCYVRILLLMEGRNWCLII,WSCQIVSNVHYSTEANLHIGALLGFLCEEQQISEKLLSLHYKHMDVTKGYCCWRAEIGVSS

Amino Acids from 3' Exons

KNRCLYVFGGQRSKTYLNDFFSYDVDSDHVDIISDGTKKDSGM,KIVAYMYLVASDQRPIMISLVMMWTLIMTYQMAPRKTLGW,KSLLICIWWPAIKDLFEFLLCGLSCRHNIRWHQERLWD