McDonnell Genome Institute

Washington University

CircRNA

chr7|131399240|131429145|+|MKLN1|ENST00000352689.10

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.983

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

5

Peptide

DTEKEYR

Amino Acids from 5' Exons

YREQEAIRLCLKHFRQHNYTEAFESLQKKTKIALEHPMLTDIHDKLVLKGDFDACEELIEKAVN,TVNRKLFAFANTSDNTTIQKLLSHCKRKPRLHWNIPCQIFMTSWCRVILMLAKSLKRLM,PTGSYSPLPKTLQTTQLYRSFVTAKENQDCTGTSHVNRYSQAGVEGFCLRRVDKGCK

Amino Acids from 3' Exons

RLFICLVAGMEHKILLTSGRTVRRTSGHVSLETLKK,DCLFVWWLGWNTRSCLLGVQCEGEPVDMYLRHKR,TVYLFGGWDGTQDLADFWAYSVKENQWTCISRDTEKE