McDonnell Genome Institute

Washington University

CircRNA

chr7|129480784|129483046|+|STRIP2|ENST00000249344.6

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9082

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

9

Peptide

MNDDWAYGNGSWR

Amino Acids from 5' Exons

EAGDNSQFCWRNLFSCINLLRLLNKLTKWKHSRTM,KLETTASSAGGTSFPASTSGCSINPNGNIPGP,SWRQQPVLLEEPLFLHQPPEAAQTDQMETFPDH

Amino Acids from 3' Exons

MLVVFKSAPILKRALKVKQAMLQLYVLKLLKLQTKYLGRQWRKSNMKTMSAIYQKVRHRMNDDWAYGN,CWCLNRHQSSGPSRSNRPCCNFMSSYSYRPSTWGANGGKATKPCQPFTRKCVTATMTGLTGM,AGSVIGTNLKAGPQGQTGHAATLCPKATKVTDQVPGAPMEEKQHENHVSHLPESASPHERLGLRE