McDonnell Genome Institute

Washington University

CircRNA

chr7|129458214|129483046|+|STRIP2|ENST00000249344.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9796

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

6

Peptide

TGLTGMQLLTK

Amino Acids from 5' Exons

QLLTKQDSLDIYNERDLFKTEEPATEEEEESAGDGERTLDGELDLLEQDPLVPPPPSQAPLSAERVAFPKGLPWAPKV,NSSLSRTAWTSTMKGISSRLRSPPQRRKRSLLVMENEPWMESTCSRTLWCHLHPHRHPSLLSGWLFPRACPGPQRS,TPHAGQPGHLQKGSLQDGARHRGGRGVCWWRTNLGWRARPARAGPSGATSTLTGTPLCAGGFSQGPALGPKGQ

Amino Acids from 3' Exons

MLVVFKSAPILKRALKVKQAMLQLYVLKLLKLQTKYLGRQWRKSNMKTMSAIYQKVRHRMNDDWAYGN,CWCLNRHQSSGPSRSNRPCCNFMSSYSYRPSTWGANGGKATKPCQPFTRKCVTATMTGLTGM,AGSVIGTNLKAGPQGQTGHAATLCPKATKVTDQVPGAPMEEKQHENHVSHLPESASPHERLGLRE