McDonnell Genome Institute

Washington University

CircRNA

chr7|128997388|129015135|-|TNPO3|ENST00000265388.9

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9962

16

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

LFMASSK

Amino Acids from 5' Exons

VVEISFNFWYRLGEHLYKTNDEVIHGIFKAYIQRLLHALARHCQLEPDH,KFHLTFGTDWGNICTKLTMKLFMASSKLTFRGCFTPWLDTASWNQT,SRNFILLVPTGGTFVQNRSYSWHLQSLHSEAASRLGSTLPAGTRP

Amino Acids from 3' Exons

IQQCDFFAFFAGDPYSVTRSTSFLTNWSSAHRNYRRFGLLLYSSISI,YSNDVTSLPFLLEILTVLPEEVHSRSLRIGANRRTEIIEDLAFYSSTVVSLL,TAMMLLCLFCWRSLQCYLKKYIVVPYELELIGAQKLKIWPSTLVQYLY