McDonnell Genome Institute

Washington University

CircRNA

chr7|128840022|128840970|+|FLNC|ENST00000325888.12

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9241

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

16

Peptide

SADFVVEAIGTEVGTLACNPNACRASGR

Amino Acids from 5' Exons

PVTPTPAAPLGEACSPRVFAKRWLTSRCLPRVPAAGSSRSRSRGQ,LPQRLPRLWARPAAQGCSRERGGLQGVYQGCRQRGAQGHGQGA,CNPNACRASGRGLQPKGVRVKEVADFKVFTKGAGSGELKVTVKGP

Amino Acids from 3' Exons

PLGTGEPRGRSAKGPGLGSWFGDWPGGQVSRFCGGSHWHRGGDT,PFEVQVSPEAGVQKVRAWGPGLETGQVGKSADFVVEAIGTEVGTL,PLRYRAQRQECKRSGPGVLVWRLARWASQPILWWKPLAPRWGHW