McDonnell Genome Institute

Washington University

CircRNA

chr7|128313174|128315020|-|RBM28|ENST00000223073.6

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9662

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

3

Peptide

QQLSSEQQK

Amino Acids from 5' Exons

VAGQRQSEARPSQKAKATDKPVEAGEAAIIVRA,LRDKGKVKPVHPKKPKPQINQWKQEKQQLSSEQ,CGTKAKSPSIPKSQSHRTSGSRRSSNYRPS

Amino Acids from 3' Exons

QKMRSKPATGEPQKGQPEPAKDQQQKAAQHHTEEQSKVPPEQKRKAGSTSWTGFQTKAEVEQVELPDGKKRRKVLALPSHRGPKI,KKDPSLQLVSLRRGNQSLQKTSNRRQLNTTQRNKARCPQSRRERRALPHGPGSRPRLKWSRWSCLMERREERSWRSPHTEAPKS,KNEIQACNWASEGATRACKRPATEGSSTPHRGTKQGAPRAEEKGGLYLMDRVPDQGSGAGGAAWKEEKKGPGAPLTPRPQNQ