McDonnell Genome Institute

Washington University

CircRNA

chr7|12369544|12373247|-|VWDE|ENST00000275358.7

Cancer

Type of Peptide

BRCA-Luminal A

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9584

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

LEHLCFIR

Amino Acids from 5' Exons

DFTRKKHVHTASFYDITWKAILLLFIGHCSVSVFRRSGQCFSIRNCLGLQRPQSCQLIFFDTRTRCHLRIYFRHSCQRDKQAYISRRISKFISARKKTHKPDTRLKCTKTSWKERRFTTIFGQEIYTRPGKPQPRNEVQSTKQMETAELSVSSFVCFPESQPNGSGRTYLFFPRGPCGCTARVFPLLAHSLWPHRVHLDPLSGDSSQLQHRKAVSCFSWQEIRQCYRDVCEGCSVKRSLGRSRCGPFRKMKEDCGGGEIHRRVWHINRHSLSIKMPQFMQRQWAVHGMGVCVFPKLFLLQFL,ILPGKSMSDTLPVSMTSPGKPSYCSCSLDTAAYPSSEDLDSVSRSEIALGCKDLNHVSLSSLIPELDVTSEYINSDTLVREINKHTSPEEYNLNLFLQEKKHINLTKLGLNVQKHPGNEKEDSLQYLANKKYTQGRGSHSQEMRYNRQNRWKRQNFHEFPPLFAFPSLSQTDLEELTYFFPEDHAEDVQQEFFPSWPTPSGLTEYSTLTLCQETLANSSIGRLCLAFLGKRLDSVIEMCVKDVLLKDDLSWAEAGVALLENECEKRIVEEGKYNTEEYGTSIEDILSVLKCPNLCSGNGQCMEWGCACSPSFSSYDCSDSY,FYQEKACLTHCQFLHHLESHPIVAVHWTLQRIRLPKIWTVFLDQKLPWVAKTSIMSAYLLYQNMSPPNILIQTLLSERTSIHLQKNIIIYFCKKKNTTLNSAMYKNILEMRKKIHYNIWPIRNIHKAGEATAKKGTIDKTDGNGRTFMSFLLCLLSRVSAKRIWKNLLIFSQRTMLRMYSKSFSPLGPLPLASPSIAPPSVRRLPTPAEGCVLLFLARDTVLRCVRMFCKMILVGQKQVWPFKMNVKRGLWRRGNITQKSMAHQLKTFSQYNAPIYAAAMGSAWNGGVRVPQALVPMTAVIPM

Amino Acids from 3' Exons

GIFQDWNICALEYVTFSPCTSVGLQKPSLSSVMLWVCCPGRRYSYFYVQWSATITTIFVHKKPRCNQEYQDKILLRKKSH,VYDNFKTGTFVLYKSMSRDFEVHVRQWDCRSLHYPVSCNCGFVAQEGGDIVTFDMCNGQLRESQPYLFIKSQDVTRNIKISESYLGRKVT,YMIISRLEHLCFIRVCHVILKSMYVSGTAEAFTIQCHVIVGLLPRKEVILLLICAMVSYVNHNHICSKAKMPGISRVNLTEEKS