McDonnell Genome Institute

Washington University

CircRNA

chr7|122393440|122491420|-|CADPS2|ENST00000313070.11

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9748

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

13

Peptide

LANIPLLCAVIEK

Amino Acids from 5' Exons

HFCVMENFTNTCKKSLYPWLSAMWISWSLPSPSQFTEVLSRRHGSLS,TFVWKISQTLARNLCTLGCPLCGSHGVFHRPVNSQRFAGDMAACQ,LLCNGKFHKHLQEIFVPLVVRYVDLMESSIAQSIHRGFEQETWQPV

Amino Acids from 3' Exons

VSQYTFAMCSYREKKSEPQELMQLEGYTVDYTDPHP,LANIPLLCAVIEKRSLNHKNCSLKAILWIIPIPTQ,PIYLCYVQLRKEVTTRINAARLYCGLYRSPP