McDonnell Genome Institute

Washington University

CircRNA

chr7|122345573|122491420|-|CADPS2|ENST00000313070.11

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9633

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

12

Peptide

LFDVSQYTFAMCSYR

Amino Acids from 5' Exons

KPGMDLADTYIMFVRQNQDILREKVNEEMYIEKLFD,NQEWIWQTPILCLFGKTKIFFEKRSMRKCIKSYL,TRNGSGRHLYYVCSAKPRYSSRKGQGNVYRKVI

Amino Acids from 3' Exons

VSQYTFAMCSYREKKSEPQELMQLEGYTVDYTDPHP,LANIPLLCAVIEKRSLNHKNCSLKAILWIIPIPTQ,PIYLCYVQLRKEVTTRINAARLYCGLYRSPP