McDonnell Genome Institute

Washington University

CircRNA

chr7|122098449|122133741|-|AASS|ENST00000417368.6

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9426

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

15

Peptide

YIGLDWAGWGSASPR

Amino Acids from 5' Exons

DLTRIKLNSARNIILILLAWTFVNKKRSWASWWQNRILSS,IHEESNTVRQEIYSCHGHLTRREAGLLGGKTGSCHQ,SDMKNQIEQLGKKYNINPVSMDICKQEEKLGFLVAKQDLVI

Amino Acids from 3' Exons

SPGVKMLQVHRTGLGRLGVSLSKGLHHKAVLAVRREDVNAWERRAPLAPKHIKGITNLGYKVLIQPSNRRAIHDK,HQVSRCCKYIGLDWAGWGSASPRVFTTKLCWPSGGRMTPGREGPRLPSTSKASPIWDTRSYSLRIGGPFMI,TRCQDAASTDWTGQAGGQPLQGSSPQSCVGRPEGGCERLGEKGPASSQAHQRHHQSGIQGLDTAFESAGHS