McDonnell Genome Institute

Washington University

CircRNA

chr7|121967950|121976851|+|PTPRZ1|ENST00000393386.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.963

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

FGALNQK

Amino Acids from 5' Exons

EHIKKIGERNIQHVIAQNNLLSILMKILHKMILRNLNFRVGIKHHWKTHSFITLGKQ,STESKKLGKEISNMPKTISYQYRSYTSKCESETISGLGNIIGKHIHSHWEN,ALNQKNWGKKYPTCNSPKQSPINIDEDLTQVNVNLKKLKFQGWDKTSLENTFIHNTGKT

Amino Acids from 3' Exons

VGTEENLDFKAIIDGVESVSRF,LGQKKIWISKRLLMESKVLVVL,WDRRKFGFQSDYWSRKCSF