McDonnell Genome Institute

Washington University

CircRNA

chr7|117099761|117209937|+|ST7|ENST00000265437.9

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9286

26

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

14

Peptide

VEGALNLLHCTWEGMSMFLNTLTPK

Amino Acids from 5' Exons

ACFTHHRSSTWPQALPHYQGLF,EHVFEHINTEVLRGPNRHFLTNIRAYF,SMFLNTLTPKFYVALTGTSSLISGLIL

Amino Acids from 3' Exons

YLLEMKSLILPPEHILKRGDSEAIAYAFFHLAHWKRVEGALNLLHCTWEG,TYKKASYPQNISREETVKQHMHSFILHTGREWKGLIFCIVRGKA,PTRNEKLNPTPRTYPEERRQSNSICILSSCTLEESGRGFESFALYVGR