McDonnell Genome Institute

Washington University

CircRNA

chr7|11481787|11636961|-|THSD7A|ENST00000423059.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9719

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

4

Peptide

SILAYAGEEGPWGR

Amino Acids from 5' Exons

EKKLTDSCAEMPSSPSLWPVMPHARKTVCSAHGLRGPPAHTPAQGKRQKGNRYEHDPFWPMRVKK,RRSQTAVQRCHLPHPCGLCPMPERLCAQHMVYVVLLLTHLLRENDRRETDTSTIHSGLCGR,EEVDRQLCRDAIFPIPVACDAPCPKDCVLSTWSTWSSCSHTCSGKTTEGKQIRARSILAYAGEE

Amino Acids from 3' Exons

VHGADVWEMNVVPEASKRGLCGVLMWRDGLHCILTVSRPRDPITSRIVSKFAIGTKSCTTGDWDLGISVSPFQKARNLLSALRGKKVFRGRRASRKTKTFLRRISSVSTLSPSLSWSRLASFLASKIASCLNFLPGPNAPRPAAAGSSTGRVMWWRPRSSEALAVQTRSSRCANPVHARPRSSGTACMWGPGAPAQCPTPDKDKQGDAGRIKNGKRTAAKERIQKPASLLRKRETETGRTDKRTNIGTSRLDIRPERLCALTRRGKLLI,SMGPMYGRMWSRRHPNEGCVVCSCGGMDYTAYLAGRETQPAELFQSLRLAQRVVRLETGTLESVSARDFKKPRETSVHGGRRYSGEGDSVHPERQRHSCGGYHLVLAQASPGAGLPHSLPARLHRVIFCLVRMLQDLRQRAPAPDASCGGAPAVRRLWLSKPDGVPGVPIQSMRGRGAQVQPACGALEHLLNAPLPTSKTSKETREERTGKGPQQRSKGSRSPRAYEKEKQKQAEQTREQILGHPDWISDQRGYVHQDGESCFK,PWGRCMGDECGPGGIQTRAVWCAHVEGWTTLHTNCKQAERPNNQQNCFKVCDWHKELYDWRLGPWNQCQPVISKSLEKPLECIKGEEGIQVREIACIQKDKDIPAEDIICEYFEPKPLLEQACLIPCQQDCIVSEFSAWSECSKTCGSGLQHRTRHVVAPPQFGGSGCPNLTEFQVCQSSPCEAEELRYSLHVGPWSTCSMPHSRQVRQARRRGKNKEREKDRSKGVKDPEARELIKKKRNRNRQNRQENKYWDIQIGYQTREVMCINKTGKAADL