McDonnell Genome Institute

Washington University

CircRNA

chr7|11446060|11481982|-|THSD7A|ENST00000423059.8

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9656

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

5

Peptide

CNSHGEEVDR

Amino Acids from 5' Exons

EKVKRRKNVKIPICIPLRLSIVLVTNIMHNLWGTGQTVFYQREKWKCCWEKYKETSRNADKDIVTKQWHATIKMAGLWKHLDVTAM,KKKEGKMKFPFVSPDDSVLSLQICTTCGELVRLYFTRGKSGSVAGNESTRRHQGMRTRISLPSNGMLRSKWQACGNIMQP,KSKKKEKCKNSHLYPLIETQYCPCDKYNAQPVGNWSDCILPEGKVEVLLGMKVQGDIKECGQGYRYQAMACYDQNGRLVETSRCNSH

Amino Acids from 3' Exons

EKKLTDSCAEMPSSPSLWPVMPHARKTVCSAHGLRGPPAHTPAQGKRQKGNRYEHDPFWPMRVKK,RRSQTAVQRCHLPHPCGLCPMPERLCAQHMVYVVLLLTHLLRENDRRETDTSTIHSGLCGR,EEVDRQLCRDAIFPIPVACDAPCPKDCVLSTWSTWSSCSHTCSGKTTEGKQIRARSILAYAGEE