McDonnell Genome Institute

Washington University

CircRNA

chr7|10990702|11038855|+|PHF14|ENST00000403050.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.913

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

4

Peptide

ITGQDSLILEK

Amino Acids from 5' Exons

DSLILEKSQNWSSQKMDHILICCVCLGDNSEDADEIIQCDNCGITVHE,TRFLRRVKTGALKKWTIFFAVFVWEIIVRTLMKFSVTIVALQSMK,LADSEESKLELSKNGPYSDLLCLSGRGRNNSVQLWHYSP

Amino Acids from 3' Exons

LCESLEELQNLNGKLRSEGQGIWALLGRITGQ,YVNLKNYKTMENFEVKDKEYGLYAESQG,MIFRRTTKPEWKTSKRTRNMGFTRQNHRA