McDonnell Genome Institute

Washington University

CircRNA

chr7|108514435|108515447|-|PNPLA8|ENST00000453085.1

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9189

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

SVYLFSEK

Amino Acids from 5' Exons

CKKCLWEAEKQATVFLVLTALLEDKPHQSTKRFSYKHNKMMDQKSTFLQALLLSKQPWFTYWDFETHFCSQGTYKSEHLYVPYKYFELCFKGCFWQSKNDFTFSSIAKFPNFKKSIGWLVKTEKHQTSHQISEKIQISRKESFSRREKSHYRQRRRYRTQSFSLHKFYNHKIWRLILLFIKSYFIFQTGKNVSTKGKTFPGQIRTRKGRRGEIKISRSWHPGLARLRICTYGGQAYKSFCDTCSSSFNTKYCLSFSSHGRCTSFSRWLYWWTCPQIKVFKESVRRTGRACNSGCQQRQKCRGEKAFISSARK,NARSVCGKQRSKQLYFLFSPKHYWRISHISLQRGFHTNIIRCKWTKSEAHSCSKHCYSPSNHGLHIGILKLSTSAPKGLTKVNICMSRIKSTLNSVSKAVFGNQNEMISRLAQFKPSSQILRKVSDSGWLKQKNIKQAIKSLKKYSDKSAEKSPFPEEKSHIIDKEEDIGKRSLFHYTSSITTKFGDSFYFLSNHINSYFKRKEKMSQQKENEHFRDKSELEDKKVEEGKLRSPDPGILAYKPGSESVHTVDKPTSPSAIPDVLQVSTKQSIANFLSRPTEGVQALVGGYIGGLVPKLKYDSKSQSEEQEEPAKTDQAVSKDRNAEEKKRLSLQREK,MQEVFVGSREASNCISCSHLSITGGATSVYKEVFIQTDVNGPKVKHILAVSTVTLQATMVYILGFNLALLLPRDLQKTFVCPVLKVLTLFQRLFLAIKMKFHVLNLSQVPKFEKYRIVAGNRKTSNKPSNLKNIVTNQQKRVLFQKRKVTLTKKKIVNAVFFITQVLPQNLETHSTFYQIILIHISNVRKKCLNKRKMNISGTNQNLKIKRKRGNDLQILASWLISQAQNLYIRWTSLQVLLRYLMFFKFQLNKVLLTFFLVPRKVYKLVVILVDLSPNSMIQRVSQKNRKSLLKLIRLSAKTEMQRRKSVYLFSEK

Amino Acids from 3' Exons

CKKCLWEAEKQATVFLVLTALLEDKPHQSTKRFSYKHNKMMDQKSTFLQALLLSKQPWFTYWDFETHFCSQGTYKSEHLYVPYKYFELCFKGCFWQSKNDFTFSSIAKFPNFKKSIGWLVKTEKHQTSHQISEKIQISRKESFSRREKSHYRQRRRYRTQSFSLHKFYNHKIWRLILLFIKSYFIFQTGKNVSTKGKTFPGQIRTRKGRRGEIKISRSWHPGLARLRICTYGGQAYKSFCDTCSSSFNTKYCLSFSSHGRCTSFSRWLYWWTCPQIKVFKESVRRTGRACNSGCQQRQKCRGEKAFISSARK,NARSVCGKQRSKQLYFLFSPKHYWRISHISLQRGFHTNIIRCKWTKSEAHSCSKHCYSPSNHGLHIGILKLSTSAPKGLTKVNICMSRIKSTLNSVSKAVFGNQNEMISRLAQFKPSSQILRKVSDSGWLKQKNIKQAIKSLKKYSDKSAEKSPFPEEKSHIIDKEEDIGKRSLFHYTSSITTKFGDSFYFLSNHINSYFKRKEKMSQQKENEHFRDKSELEDKKVEEGKLRSPDPGILAYKPGSESVHTVDKPTSPSAIPDVLQVSTKQSIANFLSRPTEGVQALVGGYIGGLVPKLKYDSKSQSEEQEEPAKTDQAVSKDRNAEEKKRLSLQREK,MQEVFVGSREASNCISCSHLSITGGATSVYKEVFIQTDVNGPKVKHILAVSTVTLQATMVYILGFNLALLLPRDLQKTFVCPVLKVLTLFQRLFLAIKMKFHVLNLSQVPKFEKYRIVAGNRKTSNKPSNLKNIVTNQQKRVLFQKRKVTLTKKKIVNAVFFITQVLPQNLETHSTFYQIILIHISNVRKKCLNKRKMNISGTNQNLKIKRKRGNDLQILASWLISQAQNLYIRWTSLQVLLRYLMFFKFQLNKVLLTFFLVPRKVYKLVVILVDLSPNSMIQRVSQKNRKSLLKLIRLSAKTEMQRRKSVYLFSEK