McDonnell Genome Institute

Washington University

CircRNA

chr7|107978046|107986363|-|LAMB1|ENST00000222399.10

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9726

14

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

IYLGDLLK

Amino Acids from 5' Exons

VHGHCMCRHNTKGLNCELCMDFYHDLPWRPAEGRNSNACK,FTDTACAGITPRATVNSAWISTMIYLGDLLKAETATPVK,SRTLHVQAHQGLKLTLHGFLPFTLETCRPKQQRL

Amino Acids from 3' Exons

TFRPAAMLIERSSDFGKTWGVYRYFAYDCEASFPGISTGPMKKVDDIICDSRYSDIEPSTEGE,HSVQLLCNDRPTLGKPGVCIDTSPMTVRPRFQAFQLAPKKSMTFVILDILTLNPQLKE,IPSSCYADRTIVRLWENLGCVILRLLGLVSRHFNWPHEKSRHNLFSIFHTLNRR