McDonnell Genome Institute

Washington University

CircRNA

chr7|107298141|107372760|-|COG5|ENST00000297135.7

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9206

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

4

Peptide

KPDYEIQLK

Amino Acids from 5' Exons

LRCFSRHLKENTLNYYVFIMTYGSVFNNTVSISKGILMQVELQTSMLTYNTWKMMHKIYSYQKSQIM,FDVFEAGIRRIPIITSLLMEASSTIQSAYPREFCKWNYRPLCPTTHGRCTRYIHTKKARL,SMFLKQAFEGEYPKLLRLYNDLWKRLQQYSQHIQGNFNASGTTDLYVDLQHMEDDAQDIFIPKKPDY

Amino Acids from 3' Exons

NPTQVGTALQVFYNLGTLKDTITSVVDGYCATLEENINSALDIKVLTQPSQSAVR,IQLKSEQLFRFSIILELRILLPVLWMDIVLLKKISTVHTKFLSLPSQLE,SNSSRNSSSGFLSWNFEGYYYQCCGWILCYFRRKYQQCIRHKSFDSAFPVSCE