McDonnell Genome Institute

Washington University

CircRNA

chr7|107283570|107283732|-|COG5|ENST00000297135.7

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.952

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

3

Peptide

TIASPEK

Amino Acids from 5' Exons

SRKGFERLTTTLGCLSIKILISTLRSYQLGFSPGWSSSFLTWYYNYSK,PEKALKDSLQPYEAAYLSKSLSRLFDPINLVFPPGGRNPPSSDELDGIIKTIA,QKRLKTHYNPMRLLIYQNPYLDSSILSTWFFPRVVVILLPLMNLMVLLKLQ

Amino Acids from 3' Exons

SRKGFERLTTTLGCLSIKILISTLRSYQLGFSPGWSSSFLTWYYNYSK,PEKALKDSLQPYEAAYLSKSLSRLFDPINLVFPPGGRNPPSSDELDGIIKTIA,QKRLKTHYNPMRLLIYQNPYLDSSILSTWFFPRVVVILLPLMNLMVLLKLQ