McDonnell Genome Institute

Washington University

CircRNA

chr7|106253016|106263617|-|NAMPT|ENST00000222553.7

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.951

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

7

Peptide

NMVSTITAWGK

Amino Acids from 5' Exons

INVFKDPVADPNKRSKKGRLSLHRTPAGNFVTLEEGKGDLEEYGQ,LTSSRTQLLIPTKGPKRADYLYIGRQQGILLHWRKEKETLRNMV,RLQGPSCSQQKVQKGPIIFTDASREFCYTGGRKRRPGIWS

Amino Acids from 3' Exons

YHNSLGERPKRCFTYCNTVFISACICGQRLHLCVENMGRSKTFNSIKKYTGTTNNQTFWKPSHCVK,TITAWGKDHEKDAFEHIVTQFSSVPVSVVSDSYDIYNACEKIWGEDLRHLIVSRSTQAPLIIRPDSGNPLDTVLK,PQLGGKTMKKMLLNILHSFHQCLYLWSAIAMTFIMRVRKYGVKIDIYQEVHRHHSDLILETLLTLC