McDonnell Genome Institute

Washington University

CircRNA

chr7|105548553|105565648|+|RINT1|ENST00000257700.6

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9087

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

QDELLTEPK

Amino Acids from 5' Exons

RITYAKATPRKILSSCLPFCHPAHPGYADSSSEEVQVSLQREPADCVKQ,DELLTEPKQLPEKYSLPASPSVILPIQVMLTPLQKRFRYHFRGNRQTNVLSK,MNYLLSQSNSQKNTLFLPPLLSSCPSRLCLLFRRGSGITSEGTGRLMCA

Amino Acids from 3' Exons

IILANHFNEGGAAQLQFDMTRNLFPLFSHYCKRPENYFK,FLLITSMKEEQPSCSLILGIFSLCFLTIARDQKIILN,NSCSLQRRSSPAAVYDSESFPFVFSLLQETRKLFT