McDonnell Genome Institute

Washington University

CircRNA

chr7|103556976|103572260|-|RELN|ENST00000343529.9

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9363

30

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

14

Peptide

LQALPASNQELEMK

Amino Acids from 5' Exons

VPQRDLTLFCYNSPSVEESLGTWMNFTFLKQRIYFSSMFPCHTLPKPMLQDSDSGNLIIT,YPREISLYSVTILHQWRNHLAPDGILLSSNNEYTFHQCSLAIHCPNQCYKIQTLATL,TPERSHSILLQFSISGGITWHLMDEFYFPQTTNILFINVPLPYTAQTNATRFRLWQPYNN

Amino Acids from 3' Exons

TCSILYTNWKQNFRHYLHQTKNK,LVQFYIQIGSKTSGITCIKPRTRNE,LFNFIYKLEAKLQALPASNQELEMK