McDonnell Genome Institute

Washington University

CircRNA

chr7|103303841|103310475|+|PMPCB|ENST00000249269.8

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9925

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

19

3

Peptide

NAVEILADIIQNSTLGEAEIER

Amino Acids from 5' Exons

LKFLLIYKTAHWEKQRLNVSVESLERCRKLKPIYKKLFLIIFMPQLIKILHLDGQFWDQLKIS,CRNSCYNTKQHIGRSRDTAWSNPRDAGSNQFTRSCFLSSCHSLSKYCTWTDNFGTNKYQ,VEILADIIQNSTLGEAEIERERGVILREMQEVETNLQEVVFDYLHATAYQNTALGRTILGPTENI

Amino Acids from 3' Exons

NLSSKLAQLTCHGNLCHSFQSFNTSYTDTGLWGLYMVCESSTVADMLHVVQKE,IYLASWPSSLVMAIFAIAFSLSTLPTQIQDYGDCIWFVNHPLLQTCYMLFKKN,FIQAGPAHLSWQSLPLSVFQHFLHRYRIMGTVYGLIIHCCRHATCCSKRM