McDonnell Genome Institute

Washington University

CircRNA

chr7|100881284|100882241|+|SRRT|ENST00000611405.4

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9483

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

26

2

Peptide

SESGTVAVSAVVGVNIGTMTGIGESASR

Amino Acids from 5' Exons

RVGPWPAPSGISGLPESARALLATSPRTQPATEAHEERL,EWDRGRERRSRGEYRDYDRNRRERFSPPRHELSPPQKRMRRD,SGTVAVSAVVGVNIGTMTGIGESASRHLATNSARHRSAGET

Amino Acids from 3' Exons

AGQHCRDPGCAAARDEDLQGVSPLPGLGGDGGRQALLQAGFPEATDAGFLPGAQRGV,LGSIAEIDLGVPPPVMKTFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEE,WAALQRLTWVCRRPRPSRSFSSPWMTRWMRRRPSSAIMTTSWISGGNRCRISSWRTKMRS