McDonnell Genome Institute

Washington University

CircRNA

chr7|100676534|100678299|+|GNB2|ENST00000303210.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9527

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

14

Peptide

QTFIGHESDINAVADAR

Amino Acids from 5' Exons

DARKACGDSTLTQ,MPEKHVGTQHP,CPKSMWGLNTDP

Amino Acids from 3' Exons

CPVGHDRPADSGFCWTQWGCDVPVPGPRWPHVCVRRLCLYQAVGRAGFHVPTDLHRPIRHQCSG,ALWDIETGQQTVGFAGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVA,PCGTLRQASRQWVLLDTVGMCPCPWPPMAARLCQAPVMPLSSCGTCGIPCADRPSSAMNPTSMQW