McDonnell Genome Institute

Washington University

CircRNA

chr7|100435847|100436064|-|PPP1R35|ENST00000292330.2

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

15

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

13

Peptide

AAACGAAGAGDAR

Amino Acids from 5' Exons

VRFRLTPPSPVRSEPQPAVPQELEMPVLKSSLALGLELRAAAGSHFDAAKAVEEQLRKSFQIRCGLEESVSE,SASARRPPRCGPSRSLRCRRSWRCPCRAAWPWAWSCGPQPGATLMLRRPWRNSESRSRSAAAWRRACPR,PLPPDAALPGAVRAAACGAAGAGDARAEEQPGLGPGAAGRSREPLCCEGRGGTAEKVVPDPLRPGGERVR

Amino Acids from 3' Exons

VRFRLTPPSPVRSEPQPAVPQELEMPVLKSSLALGLELRAAAGSHFDAAKAVEEQLRKSFQIRCGLEESVSE,SASARRPPRCGPSRSLRCRRSWRCPCRAAWPWAWSCGPQPGATLMLRRPWRNSESRSRSAAAWRRACPR,PLPPDAALPGAVRAAACGAAGAGDARAEEQPGLGPGAAGRSREPLCCEGRGGTAEKVVPDPLRPGGERVR