McDonnell Genome Institute

Washington University

CircRNA

chr6|83934594|83936376|+|CYB5R4|ENST00000369681.9

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9564

22

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

3

Peptide

LQIGLYYR

Amino Acids from 5' Exons

VCTTESASFPRKMLLMIRGFSVCCHQALIFKCPLGNMFTSSYLLQ,FVLQKVPVNFQGRCYSYEAFLFDAATKHSSSSAHWATCLPQATYY,LYYRKCQLISKEDVTHDTRLFCLMLPPSTHLQVPIGQHVYLKLPIT

Amino Acids from 3' Exons

VQKSHIHLYLVPYSQSSRNQFFPTINTSTFKSIPLDSSHQSLIVFRL,YRNSKAIYTCIWFLTLRVQGTSSSQQIHLLFDKNLSHWTLHTRASSSD,TEIVKPYTPVSGSLLSEFKEPVLPNNKYIYFLIKIYPTGLFTPELDRLQI