McDonnell Genome Institute

Washington University

CircRNA

chr6|83169241|83188798|-|PGM3|ENST00000512866.5

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9987

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

36

Peptide

GPNQEDNGVKLVDPLGEMLAPSWEEHATCLANAEEQDMQR

Amino Acids from 5' Exons

ESADHLAHEVSLAVFQLAGGIGERPQP,KVQITLHMKAWQYFSWLEELEKGPNQ,KCRSPCTSELGSISAGWRNWRKAPT

Amino Acids from 3' Exons

EDNGVKLVDPLGEMLAPSWEEHATCLANAEEQDMQRVLIDISEKEAVNLQQDAFVVIGRDT,KTMVNWLILWVKCWHHPGRNMPPVQMLRNKICRECLLTSARKKLICNKMPLLLVEIP,RQWCKIGSFGNVGTILGGTCHLFSKCGTRYAESAYHQRERSCESATRCLCSYWRYQ