McDonnell Genome Institute

Washington University

CircRNA

chr6|81751589|81752178|-|FAM46A|ENST00000320172.10

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

46

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

WALLGLLR

Amino Acids from 5' Exons

DPGPSGARRALHGGGRVLRHVGRAGLQPLHPPRRRLRRRRLRRRRLRRRRLRRWRQLRWALLGLLRKPYGALQCAELGASAAAGRHPERDHSDSRARQLPHARAAAEPDREGGAAAPGREAHWRPRRAPQRLGSQPCPAPGQRPGLQGPGPHLLRRPARGRGVSDCEGRRAGLPVGLLTRGGEQREDHTTHAQ,TDQGQVALGGHYMAEGEGYFAMSEDELACSPYIPLGGDFGGGDFGGGDFGGGDFGGGGSFGGHCLDYCESPTAHCNVLNWEQVQRLDGILSETIPIHGRGNFPTLELQPSLIVKVVRRRLAEKRIGVRDVRLNGSAASHVLHQDSGLGYKDLDLIFCADLRGEGEFQTVKDVVLDCLLDFLPEGVNKEKITPLTLK,LTRAKWRSAGTTWRRVKGTSPCLRTSWPAAPTSPAATSAAATSAAATSAAATSAVAAASVGIAWTIAKALRRTAMCTGSKCSGWTASARPFRFTGAATSPRSSCSRASRWCGGAWPRSALASATCASTARQPAMSCTRTAAWATRTWTSSSAPTCAGKGSFRLRTSCWTACWTSYPRGTKRRSHHSRS

Amino Acids from 3' Exons

DPGPSGARRALHGGGRVLRHVGRAGLQPLHPPRRRLRRRRLRRRRLRRRRLRRWRQLRWALLGLLRKPYGALQCAELGASAAAGRHPERDHSDSRARQLPHARAAAEPDREGGAAAPGREAHWRPRRAPQRLGSQPCPAPGQRPGLQGPGPHLLRRPARGRGVSDCEGRRAGLPVGLLTRGGEQREDHTTHAQ,TDQGQVALGGHYMAEGEGYFAMSEDELACSPYIPLGGDFGGGDFGGGDFGGGDFGGGGSFGGHCLDYCESPTAHCNVLNWEQVQRLDGILSETIPIHGRGNFPTLELQPSLIVKVVRRRLAEKRIGVRDVRLNGSAASHVLHQDSGLGYKDLDLIFCADLRGEGEFQTVKDVVLDCLLDFLPEGVNKEKITPLTLK,LTRAKWRSAGTTWRRVKGTSPCLRTSWPAAPTSPAATSAAATSAAATSAAATSAVAAASVGIAWTIAKALRRTAMCTGSKCSGWTASARPFRFTGAATSPRSSCSRASRWCGGAWPRSALASATCASTARQPAMSCTRTAAWATRTWTSSSAPTCAGKGSFRLRTSCWTACWTSYPRGTKRRSHHSRS