McDonnell Genome Institute

Washington University

CircRNA

chr6|80022323|80035417|+|TTK|ENST00000230510.7

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9323

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

12

Peptide

NMLEAVHTIHQHETK

Amino Acids from 5' Exons

KLKSIKNQRFQRVTRNSGNLRESQSVLTRILLHLQITGRFRSPEKLIQ,NRVSRTRGSREPETVAIEKVRVYPESCCIFKSLADSGVSPKSYR,TKEYQEPEVPESNQKQWQSKRKSECINQNPAASSNHWQIPELARKVNTE

Amino Acids from 3' Exons

NHGPVHLHGNGVWKYSLAKEKIHSMGTQELLEKYVRGSSHNPST,EITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQH,KSRTSTSTWWSVEILILIVGLKRKNPLIHGNARVTGKICRQFTQSINM