McDonnell Genome Institute

Washington University

CircRNA

chr6|80005841|80014586|+|TTK|ENST00000369798.6

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9495

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

2

Peptide

LEEMESEDLSGR

Amino Acids from 5' Exons

KWNPRIVAENQLIPTKETLKISLKMKTLLMNAIKFLLILQ,NGIRGFKWQRIDNFHNEQSERHKVKRPYTKLENFCYY,MESEDLSGRELTIDSIMNKVRDIKNKFKNEDLTDELSLNKISADTT

Amino Acids from 3' Exons

SVQNSHFKEPLVSDEKSSELIITDSITLKNKTESSLLAKLE,LFKIVISRNLWCQMKRVLNLLLLIQPRIKRNQVFLNK,CSKSFQGTSGVRKEFTYYYFNNPEENGIKSSSIR