McDonnell Genome Institute

Washington University

CircRNA

chr6|78946710|78955282|-|PHIP|ENST00000275034.4

Cancer

Type of Peptide

BRCA-Luminal A

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9715

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

13

Peptide

KMLMCQELLLEKG

Amino Acids from 5' Exons

IYSMSLRLSAFFEEHISSVLSDYKSALRFHKRNTITKRRKKRNRSSSVSSSAAS,FTAVCACLLSLKNTLVQFYQIINLLFVFIKEIPPKGGRKETEAALFPVVLHQ,LQHEFAPVCFLRTHFSFIRLICSSFSKKYHNQKEEEKKQKQLCFQCCIK

Amino Acids from 3' Exons

DEEKDADVPGTSTRKRK,MKRKMLMCQELLLEKG,RERCCARNFYSKKE