McDonnell Genome Institute

Washington University

CircRNA

chr6|7884358|7888848|-|BLOC1S5-TXNDC5|ENST00000439343.2

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.925

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

5

Peptide

YSVDQYK

Amino Acids from 5' Exons

VWSLDSGSYLGGTLKGIPWSGGGQDRRSRLHCTEYLQQVF,CGHCKTLAPTWEELSKKEFPGLAGVKIAEVDCTAERNICSKYS,VVIVRLWLLLGRNSLKRNSLVWRGSRSPKTALLNGISAASI

Amino Acids from 3' Exons

VDQYKGKRDLESLREYVESQLQRTETGATETVTPSEAPVLAAEPEADK,WISTRESGIWSHGSTWSRSCSAQRLERRRPSRPQRPRCWQLSPRLT,GSVQGKAGFGVTEGVRGVAAAAHRDWSDGDRHALRGPGAGSARGQ