McDonnell Genome Institute

Washington University

CircRNA

chr6|75640683|75666941|+|SENP6|ENST00000424947.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.945

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

DQQSGPK

Amino Acids from 5' Exons

QSGPKRK,SLDRKE,VWTEKK

Amino Acids from 3' Exons

SFCPVMMMMTTTELTEEKAYLLSLLIQHVLPLHHPLEKKQRMKILAEQSVNYEAFQKTQSIQLHCQEKQEKT,HFVQQRQNQKRKHISSACFSMFFPCTIHWKSRSSAKKYLQSRATTKHSRRLRVKYSYIAKKSKNERP,ILSSDDDDDNDRTNRRESISPQPADSACSSPAPSTGKVEAALNENTCRAERELRSIPEDSELNTVTLPRKARMKDQ