McDonnell Genome Institute

Washington University

CircRNA

chr6|75152332|75156523|-|COL12A1|ENST00000322507.12

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9987

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

5

Peptide

VQIVSQDSK

Amino Acids from 5' Exons

GWSVSPELRQTLCCWWMDHGASAGQILEPGVSFLVLWKSLTLAPKEYKL,DGVSHQSGRHCVAGGWIMEHRPGKFNREEFHFSYCGSLHWPQKSTN,MECLTRAEADIVLLVDGSWSIGRANFRTVRSFISRIVEVFDIGPKRVQI

Amino Acids from 3' Exons

YLKIPKPKMKKQKTQELHGNQHQGKSSTTVLSIALMGEGSKWLLRCPPQSLRQCSDFSHRPHMTSQFFLFTRWEKESLGKDQEQQ,ISRFQNPESRRNRKHNESYMETSTRESRQLPCCLSPSWEREANGCGAPHSHFDSVKATSATDHIHHSSSYLQDGRRKAARIRNN,SQDSKTLKVDEETENTMRVTWKPAPGKVVNYRVVYRPHGRGKQMVAKVPPTVTSTVLKRLQPQTTYDITVLPIYKMGEGKLRQGSGTT